Current Top Sellers
Bestsellers over the past month
LatestTrendingBestsellersStreamingReviews
BundlesModels
Review Us
Custom Films
beansbedcakechocolatecondimentscreamcustardfoamfoodgoogooeygungelubeoilpaintpiespoolpuddingshowerslimeslopspaghettistickysyrupthick
Powered by umd.net
| $6.00 | |||
| One of gunkedupgirls.umd.net hottest scenes, this is with Tallulah Tease and Chloe Davis. In this scene Tallulah gets fucked and dommed by Chloe in a pool of custard.
Off camera Tallulah says she would love to be fucked by Chloe so we decide, what... Starring:   | ||||
Includes this file:  mvi-0162-chloe-strapon-tallulah-1.mp4 50fps H.264                        | ||||
Love you, too
| $8.00 | |||
| Chloe and Liberty have decided they wanted to have some fun but cannot decide who is going to dominate who so they decide they are going to have a free for all.
In the pool and dressed in body stockings only which leave little to the imagination and... Starring:  | ||||
Includes this file: chloe__liberty_-_body_stocking_wam.mp4 51fps H.264                        | ||||
| $10.99
| ||||
| Dressed in a White Bra and Leopard coloured pants Dani, Cums and decides to tell Jess of her fantasy which happens to be playing with her favourite pink toy whilst getting gunged. Jess is on hand to tell Dani she can make this cum true, and she even... Starring:   | |||||
Includes this file: dani-cum-shot.mp4 H.264                         | |||||
| $8.00
| ||||
| Allex has decided to put her body on the line for Dj's quiz however instead of the usual gunge, Allex finds out that if she fails its nasty savoury slops.
Also for Allex we have decided to have a bit of fun and change the rules. Basically Allex ha... Starring:  | |||||
Includes this file: allexsavouryquix1_1.mp4 H.264                         | |||||
| $8.00 | |||
| In this download Chloe and Shemale model Liberty are left alone and Chloe describes how vulnerable Liberty is, before Liberty describes how he has done all her chores for the day.
Chloe however has had the hots for Liberty ever since she has arrived... Starring: | ||||
Includes this file: chloe--liberty-cops--robbers.mp4 51fps H.264                         | ||||
| $8.00 | |||
| In this download see Jem and Violet dressed as police officers slop wrestle and fuck in an almighty epic download.
Starting with both georgeous girls in police outfits Jem in an nypd Violet in a UK Police Outfit. Both girls had been arguing who had... Starring:   | ||||
Includes this file: jem-and-violet-police.mp4 51fps H.264                         | ||||
| $7.99
| ||||
| Matty has come along to watch the shoot however is intrigued and interested in joining in so we discussed and decided that he could join in and 2 girls would give him a blowjob and the worst would be gunked by Matty, however as this was being discuss... Starring:      | |||||
Includes this file: mvi_0321_matty_gets_gunged.mp4 50fps H.264                         | |||||
2 files |
| $4.00 | ||
| Found in the vaults an unseen video of Maddie when she played away at gunkedupgirls.com.
As Maddie had never played the A-Z game before, but had great fun slopping others we thought in for a penny in for a pound and sat her in the slop pool and made... Starring:  | ||||
Includes these files: maddieazgame1.mp4 H.264                         maddieazgame2.mp4 H.264               | ||||
| $8.00 | ||||
| In this download our not so state registered nurses Jem Summers and Violet both get naughty and dirty.
The scene starts with both girls in matching PVC White Dresses and nothing on underneath. Immediately the pink gunge is out and both start sloppi... Starring: | |||||
Includes this file: jemvionurse.mp4 51fps H.264                         | |||||
| $8.99 | |||
| Allex is back again and has come to play a game of play your cards right, higher or lower. The rules well there aren't really any rules, we line up 10 cards and allex just has to guess if the next in the sequence will be higher or lower.
Allex sat... Starring:  | ||||
Includes this file: allexsavouryhigherorlower.mp4 H.264                         | ||||
| $8.00 | |||
| Chloe has ordered slave Tallulah to come to her Dexter Dungeon as she is board and fancies some fun. On arrival Tallulah is ordered to strip lay down in a pool of mess and prepare herself for some cake making fun.
Already naked when the scene start... Starring: | ||||
Includes this file: chloe--tallulah-cake.mp4 50fps H.264                | ||||
2 files |
| $7.00
| |||
| After a lot of negotiating, maddie finally agreed to shoot for us so here is the first of a few scenes we did. The first was a game of guess the mess using her feet, wearing just a bra and thong and lace see-through top maddie is sat in the gunk poo... Starring: | |||||
Includes these files: maddieguessthemessfeet.mp4 H.264                        maddieguessthemessfeet2.mp4 H.264                         | |||||
2 files |
| $6.00 | ||
| Maddie defects once again to gunkedupgirls.com and plays a game of What's inside my Kinder Suprise in her bikini. The rules are simple Maddie has to pick a kinder egg and what ever is inside gets messy with it. Maddie gets covered in:
Tomato sauce... Starring: | ||||
Includes these files: maddieplayswhatsinsidemykindersurprise.mp4 H.264                   maddieplayswhatsinsidemykindersurprise1.mp4 H.264                | ||||
| $8.99 | |||
| Pimp Daddy Matt has called on his hoes and decides they need to be punished for reports of sub standard service and not satisfying clients well enough.
Cheyenne and MacKenzie are then made to give Matty a blowjob and whoever is the best escapes gett... Starring:   | ||||
Includes this file: mvi_0455_mackenzie_page_baked_bean_phobia.mp4 50fps H.264                      | ||||
| $8.99 | ||||
| Kim has literally cum to try out gunkedupgirls latest idea, a porridge tank. We have a brimmed full tank of porridge all awaiting to be released over Kim, however to get the tank to release the porridge, Kim has to cum.
Naked and armed with a dildo... Starring:  | |||||
Includes this file: themuckypup-porridge.mp4 H.264                     | |||||
| $7.99 | |||
| Jess has come to the end of term at tickle school and its time for her end of term review with school headmistress Dani. Dani runs a strict and severe regime and has decided that failure is not an option and if students do fail they will be forced t... Starring: | ||||
Includes this file: jess-tickle-torture.mp4 H.264                         | ||||
| $6.00 | |||
| Tallulah has been sentenced and is awaiting her punishment in the punishment chamber with PC Chloe about to pass the messy sentence that's been handed down.
Immediately though as well as a messy punishment it's clear that Chloe has took a shine to T... Starring: | ||||
Includes this file: mvi-0164-chloe-tallulah-police-convict-1.mp4 50fps H.264                         | ||||
| $5.00 | |||
| After a day of being messed and covered in multiple savoury items and porridge by MyPie, Kym decides she wants to have a bot of fun and get her own back. After discussing an idea and hatching a plot with Dj Kym goes to work.
Whilst all the days cle... Starring:  | ||||
Includes this file: mypie-porridge-tank.mp4 H.264                       | ||||
| $8.00 | |||
| Wonder Woman Chloe and Bartgirl Libby are set to go toe to toe in a battle to see who's the best at sploshing and getting sexy whilst there doing it.
Libby and Chloe are in the pool dressed in their costumes and immediately Chloe gets the upper hand... Starring: | ||||
Includes this file: chloe-and-liberty-superheros-1.mp4 51fps H.264                        | ||||
| $8.00 | |||
| Jem and Violet have been cleaning the studio including the dungeon the gangbang room and the shower area when they find an area of the studio they have never been allowed access to before but have seen models leave covered in gunge and food.
Both en... Starring: | ||||
Includes this file: mvi-0186-jem-and-violet-maids-11.mp4 50fps H.264                         | ||||
| $6.00 | ||||
| Pixiee and Sade took a sneaky look in our studio store room and saw lots of cake and cream and started asking what they were all for, so we told them they were for sitting on.
Both girls were quite enthusiastic at the thought of sitting on cold cake... Starring:   | |||||
Includes this file: mvi-0144-5-pixiee-and-sade-cake-sitting-1.mp4 50fps H.264                         | |||||
| $8.00 | |||
| Pleasured and Punished With Charlie Ten
Charlie is our first participant of a new series where models get ultimately Pleasured and equally punished.
Laid naked in the pool Charlie is naked but there is also a naked Pixiee Little holding a Dixie wan... Starring:  | ||||
Includes this file: mvi-0209-1.mp4 50fps H.264             | ||||
| $8.00 | |||
| Nuns on the gunk 2 nuns 2 strap ons 2 buckets of custard and 1 naughty girl
Sarah Jane has been called before sister Devon and Reagan as she has been caught in her fishnet body stocking with farther tony.
Devon and Reagan both get have decided tha... Starring:   | ||||
Includes this file: nuns-on--gunk.mp4 51fps H.264                         | ||||
| $8.99 | |||
| Kim Cums and Gets Creamed On
Kim has come to tell her naughty fantasy, which is to play with herself and get gunked in Cum like gunk and goo. Kim begins wearing her underwear with her favourite toy, and starts to rub it over her knickered pussy tel... Starring: | ||||
Includes this file: themuckypup-cum--creamed-on.mp4 H.264                 | ||||
| $8.00 | |||
| Kim has come to the MyPie salon for her hair to be done however what Kim doesn't know is she is the test for a new type of hair wash and blow dry a savoury gunky one.
MyPie has multiple and interesting substances to hand including eggs beans butter... Starring: | ||||
Includes this file: themuckypup-savoury-salon.mp4 H.264                        | ||||
| $8.00 | ||||
| Summer angel has come to play a game of what's inside my kinder Suprise. So for those that are unsure the rules are very simple, Summer has to open kinder eggs however we have switched the original toys with a savoury Suprise, and that is what she g... Starring:  | |||||
Includes this file: angels-savoury-initiation.mp4 25fps H.264                         | |||||
2 files |
| $8.99 | ||
| Summerangel has constantly been late for parade and has been told it's the end of the road by her Sargent. Summerangels pleads this is her career and she really want to stay and promises to do anything to get the job. On hearing the news the Sargen... Starring: | ||||
Includes these files: angel-punishment-pt1.mp4 H.264          angel-punishment-pt2.mp4 H.264                       | ||||
| $8.00 | |||
| Goldilocks "Wench" Devon has been an extreamly naughty girl whilst attending Pirate School which hasn't gone unoticed by head girl Sarah. Devon's skirt is to short and she needs to be punished. Wench isn't that worried at first after all their lady... Starring: | ||||
Includes this file: sarah-devon-reagan-pirates.mp4 50fps H.264                        | ||||
| $6.00 | |||
| Jess has always liked cakes so I thought of providing a little treat for Jess, by providing her with loads of different cakes to splat smother and get downright messy with.
Jess is so happy at being given the news she gets to mess with her favourite... Starring: | ||||
Includes this file: jess-caked-1.mp4 H.264                  | ||||
| $8.99 | |||
| Cheyenne a gunkedupgirls pro is back again and we have 2 new girls Mackenzie and Jenna. The ladies have said they want some toys and plenty of mess and we do not disappoint with full on oil fun with added toys.
See as the girls squirt oil over each... Starring: | ||||
Includes this file: mvi_0453_cheyenne_mackenzie_and_jenna_oil_and_dild.mp4 50fps H.264                         | ||||
| $6.00 | ||||
| Lola has seen the site and twitter and contacted me saying she would love to get covered in gunge. After a while a shoot was arranged and on a sunny Sunday in Derby, Lola's date with destiny came. As me and Lola got chatting and discussed the shoot... Starring:  | |||||
Includes this file: lola-cums-and-gets-creamed.mp4 H.264                    | |||||
4
scenes
|
| Bundle price: $10.00 | ||||
| A few years ago Messy Maddie of Messy Madams fame defected from Donnylad and became a gunkedupgirl for the day.
Maddie played many different games and got covered in gunge and Savoury and wore some very revealing outfits. Starring: | ||||||
This bundle saves you $9.00
| ||||||
| $6.00 | |||
| Pixiee little is a massive Derby county football fan, so we give her a challenge that she accepts straight away, which is simple, if she can turn in Jessica Jay and Allex she gets to put on her beloved Derby County top to get gunked however fail and... Starring: | ||||
Includes this file: mvi-0116-1-pixiees-football-toy-challenge.mp4 51fps H.264                      | ||||
| $8.00 | |||
| Jem and Violet are in the gunk pool but we have run out of gunk but never fear as we have oil, so naked Jem and Violet--check, bottles of oil--check, sex toys--check and it's lights camera action.
action it is indeed both girls go all out and start... Starring: | ||||
Includes this file: jem--violet-oil.mp4 51fps H.264                    | ||||
| $8.00 | |||
| Pixiee Little and Charlie Ten have come to take on the challenge most have took on before some sexy dirty oily messing and x-rated messing.
Both naked and armed with baby oil Pixiee and Charlie are in the pool and start squirting each other in baby... Starring: | ||||
Includes this file: pixiee_and_charlie_oil.mp4 51fps H.264                      | ||||
| $8.00 | |||
| Pornstar Faye Rampton has turned up to Mistress Jessica's family birthday party to entertain all the family children whilst all the adults and friends get drunk and play in Mistress's Dungeon. Mistress Jessica has an issue with Faye's slightly revea... Starring:  | ||||
Includes this file: faye-clown.mp4 50fps H.264                      | ||||
| $10.00 | |||
| What do you do when you have rented an apartment, there is cake, custard, Splurge, gunk and 4 sexy ladies all dressed provocatively, well it did not take long for us to work out what to do so we got the girls in the gunk pool and had the supplies on... Starring:   | ||||
Includes this file: 4_girl_mess.mp4 H.264                      | ||||
| $6.00 | |||
| After walking along the Cornish coast Faye spotted some little caves that were surrounded in treasure, so decided to take up a spot of pirating and get the gold, unfortunatly though she has been caught and now must be punished.
Ruler of the seas jes... Starring: | ||||
Includes this file: faye-pirate.mp4 51fps H.264                         | ||||
| $6.00 | |||
| Sade and Pixiee have come for a gunk shoot but it's thought we have 2 bottles of baby oil and what fun it would be if both ladies cover each other in oil and with some toys have some fun...
When put to Pixiee and Sade it didn't take long to decide b... Starring: | ||||
Includes this file: mvi_0138-pixiee-and-sade-rose-baby-oil.mp4 51fps H.264                         | ||||
| $8.99 | ||||
| Prison cook Faye has been called to warden Jessica's office as there has been reports that the porridge is inedible.
Faye can't see what the problem is thinks her food is fantastic and everyone lives her porridge. Jessica advises Faye this isn't th... Starring: | |||||
Includes this file: faye-prisoner.mp4 H.264                        | |||||
| $8.00 | |||
| Angela has decided to put her body on the line for Dj's quiz however instead of the usual gunge, Angela finds out that if she fails its nasty savoury slops.
Also for Angela we have decided to have a bit of fun and change the rules. Basically Angela... Starring: | ||||
Includes this file: angela-savoury-quiz-1.mp4 H.264                     | ||||
| $8.00 | |||
| It's the finale in a long day a gunkedup hq and we discover we have lots of cakes yoghurts trifles and custard left over. Also on hand are 3 naked models. After arguing who was going to wear what outfit a simple resolution was found all 3 were naked... Starring: | ||||
Includes this file: saeah-devon--regan-food-fight.mp4 51fps H.264                     | ||||
| $6.00 | |||
| Staff nurse Allex has called in Pixiee for her annual appraisal. For Pixiee the results are not good. It is not long before Allex has already decided that no words are needed and goes straight for a bucket of custard which goes straight down Pixiee... Starring: | ||||
Includes this file: mvi-0122-nurse-pixiee-1-1.mp4 50fps H.264                  | ||||
| $8.00 | |||
| In this download Sarah, Devon and Regan have come for a fun and sensual time, and we don't disappoint as they get messy, slippy and slidy in this oil wrestling video.
The scene starts with all 3 girls naked and armed with a bottle of oil. As soon a... Starring: | ||||
Includes this file: mvi-0168-devon-sarah-and-raegan-oil-1-1.mp4 51fps H.264                        | ||||
| $10.99 | ||||
| Dani has come along and wanted to attempt to tackle Dj's Quiz as she says she likes a challenge, but Dj has decided to change the rules for a new and improved look, basically all she has to do is answer 20 questions in 2 minutes or she is made to str... Starring: | |||||
Includes this file: dani-quiz.mp4 H.264                         | |||||
| $7.99
| ||||
| In this scene Cheyenne, Jenna, McKenzie and Matty are up for more fun and want to play in the gunge, so what were we to do.
In the pool orange gunge ready and all naked they all start to play
There is plenty of rolling around, spinning around, play... Starring: | |||||
Includes this file: mvi_0456_matty_jenna_cheyenne_and_mackenzie_gunge.mp4 50fps H.264                         | |||||
| $6.00 | ||||
| Jessica has decided that with multiple cakes, gateaux ustard and yoghurt left to just have some fun and throw, pour, splat and squide them all over Faye.
Faye dressed in a thong and see-through fish net top is sat ready for action. Jessica on the... Starring: | |||||
Includes this file: mvi-0087-1_1.mp4 51fps H.264                         | |||||
| $6.00 | ||||
| Maids Sade and Pixiee are doing their daily work and have stumbled across a room they have been asked to clean by their house keeper. On arrival both maids in the be spoke kinky costumes are surrounded by all mess and gunge and a very slippy oiled p... Starring: | |||||
Includes this file: sara--pixiee-maids.mp4 51fps H.264                         | |||||
| $9.99 | |||
| What do you get when you get 2 naked girls, 1 bucket of treacle, 1 bucket of golden syrup, 1 naked pourer, 1 bucket of popcorn and a naked Matty... Chaos
We have a naked Cheyenne, a naked Devon who have agreed to take part in out experiment and 1 ge... Starring: | ||||
Includes this file: mvi_0324_syrup_and_treacle_madness.mp4 50fps H.264                         | ||||
| $6.00 | ||||
| Nurse Faye has been called into review by Doc Jay for spending to much time washing the male nurses privates as the rest ofg the bed bath and all the patients wives have began writing in and complaining. However, this is not Faye's first issue thoug... Starring: | |||||
Includes this file: faye-nurse-1.mp4 H.264                       | |||||
| View Cart | Check Out | Join Streaming |
